目录号 | 产品详情 | 靶点 | |
---|---|---|---|
T19296 | Others | ||
DOTA derivatives are phenoxy derivatives of cyclic Tosamide;Direct nitrification;It is more convenient to add nitro group after removing the protection of lithium aluminium hydride. | |||
T40328 | |||
Betulinic acid derivative-1 demonstrates potent inhibition of osteoclast (OC) differentiation, achieving an IC50 value of 1.86 μM. | |||
T13853 | Others | ||
Pyridazinediones-derivative-1 has potential in treating neurodegenerative disorders. | |||
T11654 | Others | ||
Indirubin Derivative E804 is an effective inhibitor of IGF1R, which has an IC50 value of 0.65. | |||
T10106 | Others | ||
3-arylisoquinolinamine derivative is a compound with antitumor activity. | |||
T13662 | Others | ||
Diarylalkane derivative 1 is used for the research of pancreatitis. | |||
T19534 | Others | ||
Glycerol derivative 1 is a Glycerol derivative. | |||
TP1392 | |||
Exendin derivative 1 is a 39 amino acid peptide. | |||
T13593 | Others | ||
Heterocyclyl carbamate derivative 1, a heterocyclyl carbamate derivative, is used for the research of neurological diseases and inflammatory. | |||
TP1161 | |||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. |
目录号 | 产品名/同用名 | 种属 | 表达系统 | ||
---|---|---|---|---|---|
TMPH-00295 | PAG-2 Protein, Bovine, Recombinant (His) | Bovine | E. coli | ||
PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor.
|
|||||
TMPH-02461 | pylS Protein, Methanosarcina barkeri, Recombinant (His) | Methanosarcina barkeri | E. coli | ||
Catalyzes the attachment of pyrrolysine to tRNA(Pyl). Pyrrolysine is a lysine derivative encoded by the termination codon UAG.
|
|||||
TMPH-02564 | CARNMT1 Protein, Mouse, Recombinant (His & SUMO) | Mouse | E. coli | ||
N-methyltransferase that catalyzes the formation of anserine (beta-alanyl-N(Pi)-methyl-L-histidine) from carnosine. Anserine, a methylated derivative of carnosine (beta-alanyl-L-histidine), is an abundant constituent of vertebrate skeletal muscles. Also methylates other L-histidine-containing di- and tripeptides such as Gly-Gly-His, Gly-His and homocarnosine (GABA-His).
|
|||||
TMPH-01525 | CMAHP Protein, Human, Recombinant (His & Myc) | Human | E. coli | ||
Sialic acids are components of carbohydrate chains of glycoconjugates and are involved in cell-cell recognition and cell-pathogen interactions. That protein has no CMP-N-acetylneuraminate monooxygenase activity and is not able to convert CMP-N-acetylneuraminic acid (CMP-Neu5Ac) into its hydroxylated derivative CMP-N-glycolylneuraminic acid (CMP-Neu5Gc), a sialic acid abundantly expressed at the surface of many cells in vertebrates. However, it may play a role in Wnt signaling.
|
|||||
TMPH-00271 | HNRNPA2B1 Protein, Bovine, Recombinant (His & SUMO) | Bovine | E. coli | ||
Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm. Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion. Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs.
|
|||||
TMPY-00585 | Annexin A8 Protein, Human, Recombinant (His) | Human | E. coli | ||
We have previously shown that Annexin A8 (ANXA8) is strongly associated with the basal-like subgroup of breast cancers, including BRCA1-associated breast cancers, and poor prognosis; while in the mouse mammary gland AnxA8 mRNA is expressed in low-proliferative isolated pubertal mouse mammary ductal epithelium and after enforced involution, but not in isolated highly proliferative terminal end buds (TEB) or during pregnancy. ANXA8 as a potential mediator of quiescence in the normal mouse mammary ductal epithelium, while its expression in basal-like breast cancers may be linked to ANXA8's association with their specific cells of origin. Annexin A8 (ANXA8), a member of a superfamily of calcium and phospholipid binding proteins, is physiologically expressed in a tissue-specific manner, recent microarray studies reported that ANXA8 was also ectopically expressed in pancreatic cancers. We investigated the molecular mechanism of expression of ANXA8 in cancer cells and its functional role in pancreatic cancer cells. ANXA8 was diversely expressed in human cancer cell lines. Ectopic ANXA8 expression in cancer cells might involve an epigenetic mechanism. ANXA8 might play an important role in calcium fluctuation-mediated HIF-1α transcriptional activation and cell viability. The retinoic acid derivative fenretinide (FR) is capable of transdifferentiating cultured retinal pigment epithelial (RPE) cells towards a neuronal-like phenotype, down-regulation of AnxA8 is both necessary and sufficient for neuronal transdifferentiation of RPE cells and reveal an essential role for AnxA8 as a key regulator of RPE phenotype.
|